Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-WT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA |
Rabbit polyclonal antibody to WT1 (Wilms tumor 1)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544) |
Mouse Monoclonal WT1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Wilms' Tumor Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
USD 180.00
In Stock
Active filters
Target Symbol
- WT1
Applications
- IHC