Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

CA1 (Erythrocytes) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

CA1 (Erythrocytes) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

CA1 (Erythrocytes) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit anti-CA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CA1

Rabbit polyclonal anti-CA1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA1.

Carbonic Anhydrase I (CA1) (166-176) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CA1 / Carbonic Anhydrase I (NP_001729.1)

Carbonic Anhydrase I (CA1) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 67-98 amino acids from the N-terminal region of human CA1

Goat Anti-CA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAIKTKGKRAP, from the internal region of the protein sequence according to NP_001729.1.

Anti-CA1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Carbonic Anhydrase 1 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated