Primary Antibodies

View as table Download

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.

Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal.

Rabbit Polyclonal Anti-Thrombin Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor

Thrombin Receptor (F2R) (24-37) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from the Internal region (near N-terminus) of the human protein sequence according to NP_001983.2

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.

Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R.

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor

F2R Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAR1

F2R Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-110 of human F2R (NP_001983.2).
Modifications Unmodified