Rabbit polyclonal anti-GluR6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR6. |
Rabbit polyclonal anti-GluR6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR6. |
Rabbit Polyclonal Anti-GRM6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the N terminal of human GRM6. Synthetic peptide located within the following region: AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL |
Rabbit Polyclonal Anti-mGluR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-mGluR6 Antibody: A synthesized peptide derived from human mGluR6 |
Rabbit Polyclonal Anti-mGluR6 (extracellular)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)GQSDDSTRK(S)TGEE, corresponding to amino acid residues 368-381 of rat mGluR6. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GRM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the middle region of human GRM6. Synthetic peptide located within the following region: EFWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAV |
Rabbit Polyclonal Anti-GRM6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6. Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL |