Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PTHLH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Rabbit Polyclonal Anti-Pthlh Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK

Rabbit polyclonal anti-PTHrP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human PTHrP

Anti-Human PTHrP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PTHrP

PTHLH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1).
Modifications Unmodified