Primary Antibodies

View as table Download

Goat Polyclonal Antibody against CRP2 / CSRP2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1.

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Vervet Monkey, Rat, Dog, Pig, Horse, Mouse, Bovine
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.

Rabbit Polyclonal Anti-TRAK1 Antibody

Applications WB
Reactivities Human, Rabbit, Rat, Dog, Pig, Horse, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF

Rabbit Polyclonal Anti-FAM86A Antibody

Applications WB
Reactivities Guinea Pig, Human, Rat, Dog, Horse, Cow
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE

Goat Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2.

Goat Anti-SEPT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNNKNKGQLTKSP, from the internal region of the protein sequence according to NP_001779.3; NP_001011553.2.

Goat Anti-SEC23A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-ANRAATTGHVID, from the internal region of the protein sequence according to NP_006355.2.

Rabbit polyclonal anti-Oct-4 antibody

Applications WB
Reactivities Human, Monkey, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein.

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit Polyclonal Anti-SIAH3 Antibody

Applications WB
Reactivities Human, Rabbit, Dog, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA

MMP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Horse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1