Goat Polyclonal Antibody against CRP2 / CSRP2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1. |
Goat Polyclonal Antibody against CRP2 / CSRP2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1. |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal Antibody against VEGFA
Applications | WB |
Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Anti-PTBP1 Antibody
Applications | WB |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Rabbit polyclonal STAT2 phospho Y690 antibody
Applications | IHC, WB |
Reactivities | Human, Chimpanzee, Macaque, Vervet Monkey, Rat, Dog, Pig, Horse, Mouse, Bovine |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Rabbit Polyclonal Anti-TRAK1 Antibody
Applications | WB |
Reactivities | Human, Rabbit, Rat, Dog, Pig, Horse, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF |
Rabbit Polyclonal Anti-FAM86A Antibody
Applications | WB |
Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Goat Anti-HOXD10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2. |
Goat Anti-SEPT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DNNKNKGQLTKSP, from the internal region of the protein sequence according to NP_001779.3; NP_001011553.2. |
Goat Anti-SEC23A Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ANRAATTGHVID, from the internal region of the protein sequence according to NP_006355.2. |
Rabbit polyclonal anti-Oct-4 antibody
Applications | WB |
Reactivities | Human, Monkey, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein. |
Rabbit polyclonal anti-NEDD4 antibody
Applications | WB |
Reactivities | Human, Macaque, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein. |
Rabbit polyclonal anti-ATDC antibody
Applications | WB |
Reactivities | Bovine, Chimpanzee, Human, Macaque, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit polyclonal ATDC Ac-K116 antibody
Applications | WB |
Reactivities | Bovine, Chimpanzee, Human, Macaque, Horse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit Polyclonal Anti-SIAH3 Antibody
Applications | WB |
Reactivities | Human, Rabbit, Dog, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
MMP1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1 |