OPRM1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human OPRM1 |
OPRM1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human OPRM1 |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |
Rabbit polyclonal anti-OPRM1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPRM1. |
Rabbit Polyclonal Anti-Oprm1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV |
Rabbit polyclonal Anti-mu-Opioid Receptor (extracellular)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CSPAPGSWLNLSHVDGN, corresponding to amino acid residues 22-38 of the rat µ-Opioid receptor. Extracellular, N-terminus. |
Rabbit Polyclonal mu Opioid R/OPMR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide comprising residues 386-400 of the human, mouse and rat MOR-1 protein. |
Anti-OPRM1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.373~377 (H-P-S-T-A) derived from Human Opioid Receptor. |
Phospho-OPRM1-S375 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S375 of human OPRM1 |
Modifications | Phospho-specific |
Mu Opioid Receptor(MOR) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human Mu Opioid Receptor(MOR) (NP_000905.3). |