Primary Antibodies

View as table Download

Rabbit Polyclonal Slc22A17 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Slc22A17 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Slc22A17.

Rabbit Polyclonal Anti-SLC22A17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC22A17 Antibody: synthetic peptide directed towards the middle region of human SLC22A17. Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM

Anti-SLC22A17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 511-524 amino acids of human solute carrier family 22, member 17