Rabbit anti-TGFBI Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGFBI |
Rabbit anti-TGFBI Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGFBI |
Rabbit Polyclonal Anti-TGFBI Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGFBI antibody: synthetic peptide directed towards the C terminal of human TGFBI. Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA |
TGFBI (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 105-135 amino acids from the N-terminal region of human TGFBI |
Goat Anti-TGFBI, Biotinylated Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLYTDRTEKLRPE., from the internal region of the protein sequence according to NP_000349.1. |
TGFBI rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TGFBI |
TGFBI rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TGFBI |
TGF beta induced TGFBI Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 481-683 of human TGF beta induced TGF beta induced TGFBI (NP_000349.1). |
Modifications | Unmodified |