Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to SEC61A1 (Sec61 alpha 1 subunit (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 413 and 476 of SEC61A1

Rabbit Polyclonal Anti-SEC61A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEC61A1 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC61A1. Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC

Goat Polyclonal Antibody against SEC61A1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KEQSEVGSMGALLF, from the C Terminus of the protein sequence according to NP_037468.1.

SEC61A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SEC61A1

SEC61A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-420 of human SEC61A1 (NP_037468.1).
Modifications Unmodified

SEC61A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-420 of human SEC61A1 (NP_037468.1).
Modifications Unmodified