Rabbit anti-SUMO3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human SUMO3 |
Rabbit anti-SUMO3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human SUMO3 |
Rabbit Polyclonal Anti-SUMO3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUMO3 antibody: synthetic peptide directed towards the middle region of human SUMO3. Synthetic peptide located within the following region: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
Rabbit Polyclonal SUMO3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SUMO3 antibody was raised against a 13 amino acid synthetic peptide near the carboxy terminus of human SUMO3. |
Rabbit polyclonal Pan SUMO Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This Pan SUMO antibody recognizes all 3 SUMO isoforms, including human SUMO1, SUMO2 and SUMO3. This antibody is generated from rabbits immunized with a recombinant protein encoding full length human SUMO3. |
Rabbit polyclonal anti-SUMO-3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant human SUMO-3 protein. |
Rabbit Polyclonal SUMO3 Antibody
Applications | WB |
Reactivities | Equine, Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-95 of human SUMO3 (SMT3) was used as the immunogen for this antibody. |
Rabbit anti SUMO-3/Sentrin-3 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Sentrin-3 protein. This sequence is identical to human, mouse and rat. |
SUMO3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SUMO3 (NP_008867.2). |
Modifications | Unmodified |