PAX7 (411-521) mouse monoclonal antibody, clone 1E12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
PAX7 (411-521) mouse monoclonal antibody, clone 1E12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
PAX7 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 417-445 amino acids from the C-terminal region of human PAX7 |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
PAX7 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 180-210 amino acids from the Central region of human PAX |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT |
Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAX7 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAX7 mouse monoclonal antibody,clone OTI4A7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAX7 mouse monoclonal antibody,clone OTI4A7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PAX7 mouse monoclonal antibody,clone OTI4A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAX7 mouse monoclonal antibody,clone OTI4G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAX7 mouse monoclonal antibody,clone OTI4G5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAX7 mouse monoclonal antibody,clone OTI4G5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PAX7 mouse monoclonal antibody,clone OTI4G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |