Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-CGA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CGA |
Goat Anti-GLP1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHQWDGLLSYQD, from the internal region of the protein sequence according to NP_002053.3. |
Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor |
Rabbit polyclonal anti-HCRTR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HCRTR1. |
Rabbit polyclonal anti-FSHR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Orexin Receptor 1 (HCRTR1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 269-298 amino acids from the Central region of Human Orexin receptor type 1 (Center) |
hCG (CGA) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 74-103 amino acids from the C-terminal region of human TSH-alpha |
Rabbit Polyclonal Anti-HCRTR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV |
Anti-FSHR Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 28-218 amino acids of human follicle stimulating hormone receptorfollicle stimulating hormone receptor |
HCRTR1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Families
- ES Cell Differentiation/IPS
Pathways
- Neuroactive ligand-receptor interaction