Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit anti-CYP1A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP1A1 |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
Rabbit Polyclonal Aldh3A2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit Polyclonal antibody to ACMSD (aminocarboxymuconate semialdehyde decarboxylase)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 105 and 336 of ACMSD (Uniprot ID#Q8TDX5) |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ACMSD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACMSD antibody: synthetic peptide directed towards the middle region of human ACMSD. Synthetic peptide located within the following region: NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE |
Mouse monoclonal Anti-Cytochrome P450 1A1 and 1A2 Clone MC1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 1A2 Clone 3B8C1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against MAOB
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Anti-cytochrome P450 1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
USD 380.00
4 Weeks
Mouse Monoclonal Aldehyde dehydrogenase 10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI6E2 (formerly 6E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI15E2 (formerly 15E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI7A9 (formerly 7A9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI7D12 (formerly 7D12)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI8F1 (formerly 8F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP1A2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |
Anti-ACMSD Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALDH3A2 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP1A1 |
Rabbit Polyclonal Anti-CYP1A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP1A2 |
USD 379.00
In Stock
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
CYP1A2 mouse monoclonal antibody, clone 1H3, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
CYP1A2 mouse monoclonal antibody, clone 1H3, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI6E2 (formerly 6E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI6E2 (formerly 6E2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI6E2 (formerly 6E2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
In Stock
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI6E2 (formerly 6E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-CYP1A2 (Cytochrome P450 1A2) mouse monoclonal antibody, clone OTI15E2 (formerly 15E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |