Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
Rabbit anti-PRDX6 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX6 |
Anti-ADH5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Rabbit monoclonal antibody against Peroxiredoxin 6 (clone EPR3755 )
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against Catalase / CAT
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKYNAEKPKNAIHT, from the internal region of the protein sequence according to NP_001743.1. |
Rabbit polyclonal antibody to MTHFR (5,10-methylenetetrahydrofolate reductase (NADPH))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 248 of MTHFR (Uniprot ID#P42898) |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Goat Polyclonal Anti-Catalase Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified catalase isolated from liver |
Peroxiredoxin 6 (PRDX6) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Sulfonylated peptide (KLH coupled) corresponding to the active site sequence common to mammalian Prx VI |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
Goat Anti-ADH5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Anti-SHMT2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 240 amino acids of human serine hydroxymethyltransferase 2 (mitochondrial) |
Goat Anti-peroxiredoxin 6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
PRDX6 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | internal region (TAEKRVATPVD) |
Rabbit polyclonal Anti-SHMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG |
Rabbit Polyclonal Anti-ADH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH5 antibody: synthetic peptide directed towards the middle region of human ADH5 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Rabbit Polyclonal Anti-CAT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAT |