Primary Antibodies

View as table Download

C1R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human C1R.
Epitope: Amino Acids 445-494.

Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R heavy chain.

Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R.

Rabbit Polyclonal Anti-C1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ

C1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human C1R

C1R Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 466-705 of human C1R (NP_001724.3).
Modifications Unmodified

C1R Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 466-705 of human C1R (NP_001724.3).
Modifications Unmodified