Primary Antibodies

View as table Download

Goat Polyclonal Antibody against PARP2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LDLFEVEKDGEKE, from the internal region of the protein sequence according to NP_005475.1.

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Rabbit polyclonal anti-PARP2 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARP2.

Rabbit Polyclonal Anti-PARP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD

PARP2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PARP2

PARP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).
Modifications Unmodified