Primary Antibodies

View as table Download

Goat Polyclonal Anti-CB1 (isoform a) Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2.

Rabbit anti-CNR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Recombinant protein of human CNR1

Goat Polyclonal Antibody against Cannabinoid Receptor 1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTSEDGKVQVTRPDQ, from the internal region of the protein sequence according to NP_057167.2; NP_149421.1.

Rabbit Polyclonal Anti-CNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNR1 antibody: synthetic peptide directed towards the N terminal of human CNR1. Synthetic peptide located within the following region: ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL