Primary Antibodies

Jump to Filters
View as table Download
LHCGR Rabbit Polyclonal Antibody
TA308266

USD 415.00

5 Days

Rabbit polyclonal antibody to LHR (luteinizing hormone/choriogonadotropin receptor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 622 and 699 of LHR (Uniprot ID#P22888)
Lhcgr Rabbit Polyclonal Antibody
TA328868

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-LH Receptor (extracellular)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide ENELSGWDYDYGFC, corresponding to amino acid residues 327-340 of rat LH receptor. Extracellular, N-terminus.
LHCGR Rabbit Polyclonal Antibody
TA343097

USD 375.00

5 Days

Rabbit Polyclonal Anti-LHCGR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHCGR antibody is: synthetic peptide directed towards the C-terminal region of Human LHCGR. Synthetic peptide located within the following region: LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC
LHCGR Rabbit Polyclonal Antibody
TA378021

USD 220.00

3 Weeks

LHCGR Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-360 of human LHCGR (NP_000224.2).
Modifications Unmodified