Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ALG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

ALG2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog
Immunogen Synthetic peptide directed towards the C terminal of human ALG2

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-416 of human ALG2 (NP_149078.1).
Modifications Unmodified

ALG2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-416 of human ALG2 (NP_149078.1).
Modifications Unmodified

ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALG2 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated