Rabbit polyclonal Anti-Orexin Receptor 1
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RNWKRPSEQLEAQH, corresponding to amino acid residues 256-269 of rat OX1R . 3rd intracellular loop. |
Rabbit polyclonal Anti-Orexin Receptor 1
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RNWKRPSEQLEAQH, corresponding to amino acid residues 256-269 of rat OX1R . 3rd intracellular loop. |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor |
Rabbit polyclonal anti-HCRTR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HCRTR1. |
Orexin Receptor 1 (HCRTR1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 269-298 amino acids from the Central region of Human Orexin receptor type 1 (Center) |
Rabbit Polyclonal Anti-HCRTR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV |
HCRTR1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HCRTR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HCRTR1 |
HCRTR1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HCRTR1 (NP_001516.2). |
Modifications | Unmodified |