Primary Antibodies

View as table Download

Rabbit Polyclonal SCF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF.

SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Primate

SCF (KITLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hSCF (anti-hSCF).

SCF (KITLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hSCF.

Rabbit Polyclonal Anti-SCF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.

SCF (KITLG) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

SCF (KITLG) mouse monoclonal antibody, Azide Free

Applications ELISA, IF, WB
Reactivities Human

Kitlg rabbit polyclonal antibody, Aff - Purified

Applications ELISA, NEUT, WB
Reactivities Rat
Immunogen Highly pure (>98%) recombinant Rat SCF.

Kitlg rabbit polyclonal antibody, Aff - Purified

Applications ELISA, NEUT, WB
Reactivities Rat
Immunogen Highly pure (>98%) recombinant Rat SCF.

Rabbit Polyclonal Antibody against KITLG (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG).

Anti-Human SCF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF

SCF (KITLG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hSCF.

SCF (KITLG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hSCF.

Kitlg rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Rat
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant Rat SCF.

Kitlg rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Rat
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant Rat SCF.

Anti-Human SCF Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF

Anti-Rat SCF Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Rat SCF

Anti-KITLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.

Rabbit Polyclonal Anti-KITLG Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications WB
Reactivities Human
Conjugation Unconjugated

KITLG Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-214 of human KITLG (NP_000890.1).
Modifications Unmodified

KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications WB
Reactivities Human
Conjugation Unconjugated

KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications WB
Reactivities Human
Conjugation Unconjugated