Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 38 of 38 results

(reset)

SERBP1 Rabbit Polyclonal Antibody

TA345745

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERBP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SERBP1 antibody: synthetic peptide directed towards the C terminal of human SERBP1. Synthetic peptide located within the following region: PNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFG

SERBP1 Rabbit Polyclonal Antibody

TA345746

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERBP1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SERBP1 antibody: synthetic peptide directed towards the middle region of human SERBP1. Synthetic peptide located within the following region: SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4G2]

CF800686

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

CF800689

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

CF800694

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody, clone OTI4F8 (formerly 4F8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI1E7]

CF800695

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

CF800699

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI5G2]

CF800707

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody,clone OTI5G2

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]

CF800719

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERBP1 mouse monoclonal antibody,clone OTI2C11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERBP1 Rabbit Polyclonal Antibody

TA381363

USD 220.00

3 Weeks

SERBP1 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SERBP1 (NP_001018078.1).
Modifications	Unmodified

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4G2]

TA800686

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]

TA800686AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 4G2, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G2]

TA800686BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 4G2, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4G2]

TA800686S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA800689

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]

TA800689AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2F6, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

TA800689BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2F6, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA800689S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

TA800694

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody, clone OTI4F8 (formerly 4F8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F8]

TA800694AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 4F8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F8]

TA800694BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 4F8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

TA800694S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody, clone OTI4F8 (formerly 4F8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI1E7]

TA800695

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]

TA800695AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 1E7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Dog
Conjugation	Biotin

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]

TA800695BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 1E7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Dog
Conjugation	HRP

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI1E7]

TA800695S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

TA800699

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]

TA800699AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2E11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E11]

TA800699BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2E11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

TA800699S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI5G2]

TA800707

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody,clone OTI5G2

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G2]

TA800707AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 5G2, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G2]

TA800707BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 5G2, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI5G2]

TA800707S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody,clone OTI5G2

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]

TA800719

USD 379.00

In Stock

SERBP1 mouse monoclonal antibody,clone OTI2C11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

TA800719AM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2C11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C11]

TA800719BM

USD 420.00

5 Days

SERBP1 mouse monoclonal antibody,clone 2C11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERBP1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]

TA800719S

USD 159.00

2 Days

SERBP1 mouse monoclonal antibody,clone OTI2C11

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 38 of 38 results