UBN1 (1-190) mouse monoclonal antibody, clone UBN1-02, Aff - Purified
Applications | IP, WB |
Reactivities | Human |
UBN1 (1-190) mouse monoclonal antibody, clone UBN1-02, Aff - Purified
Applications | IP, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-UBN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM |
Goat Anti-UBN/ Ubinuclein 1 & 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DNSEAYDELVPASLT, from the internal region of the protein sequence according to NP_058632.2. |