Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TAC1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TAC1

TAC1 (1-11) guinea pig polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAC1 rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated

TAC1 (1-11) guinea pig polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti Substance P

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu- Met-NH2 coupled to carrier protein.

TAC1 guinea pig polyclonal antibody, Serum

Applications FC, IHC
Reactivities Fish, Human, Rabbit, Rat
Immunogen Substance P conjugated to BSA

TAC1 rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Fish, Human, Porcine, Rat
Immunogen Substance K / Neurokinin A (Peninsula) conjugated to BSA

TAC1 (1-11) guinea pig polyclonal antibody

Applications IF, IHC
Conjugation Unconjugated

TAC1 rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH

Rabbit polyclonal anti Substance P

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to carrier protein.

Rabbit polyclonal anti Substance P; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to a carrier protein.

Neurokinin A, rabbit anti Neurokinin A, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein.

Rabbit polyclonal anti Neurokinin A; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein.

Rabbit polyclonal anti Neurokinin A; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein.

Guinea pig polyclonal anti Substance P; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 coupled to carrier protein.

Anti-TAC1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 58-68 amino acids of Human tachykinin, precursor 1

TAC1 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TAC1

TAC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human TAC1 (NP_003173.1).
Modifications Unmodified

Substance P Rabbit polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Substance P