Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Goat Polyclonal Antibody against TPI1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-LKPEFVDIINAKQ, from the C Terminus of the protein sequence according to NP_000356.

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)

Rabbit anti-TPI1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TPI1

TPI1 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse TPI1

TPI1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-249 of human TPI1 (NP_000356.1).
Modifications Unmodified