Primary Antibodies

Jump to Filters
View as table Download
CYBB Rabbit Polyclonal Antibody
TA349081

USD 484.00

5 Days

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.
NOX1 Rabbit Polyclonal Antibody
TA349065

USD 484.00

5 Days

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3.
NOX1 Goat Polyclonal Antibody
TA311375

USD 375.00

In Stock

Goat Anti-NOX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1.
CYBB Goat Polyclonal Antibody
TA305618

USD 375.00

In Stock

Goat Anti-CYBB / GP91-PHOX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2.
NOX1 Rabbit Polyclonal Antibody
TA315358

USD 345.00

In Stock

Rabbit polyclonal anti-NOX1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1.
CYBB Rabbit Polyclonal Antibody
TA327116

USD 345.00

3 Weeks

Rabbit anti-CYBB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYBB
CYBB Rabbit Polyclonal Antibody
TA335229

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
NOX1 Rabbit Polyclonal Antibody
TA341879

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-NOX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
CYBB (151-163) Goat Polyclonal Antibody
AP23109PU-N

USD 440.00

2 Weeks

CYBB (151-163) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2)
CYBB Rabbit Polyclonal Antibody
TA337434

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV
NOX1 Rabbit Polyclonal Antibody
TA351455

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-NOX1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NOX1
CYBB Rabbit Polyclonal Antibody
TA351456

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB