Germany
Japan
United Kingdom
China
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10264, Purified
| Applications | ELISA |
| Reactivities | Human |
Primary Antibodies
View as table Download
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10243, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
USD 395.00
2 Weeks
Luteinizing Hormone beta (LHB) mouse monoclonal antibody, clone 090-11412, Purified
| Applications | ELISA |
| Reactivities | Human |
USD 395.00
2 Weeks
Luteinizing Hormone beta (LHB) mouse monoclonal antibody, clone 057-10037, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Immunogen | Bovine Luteinizing Hormone |
GnRH (GNRH1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
Rabbit anti-CGA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CGA |
Rabbit anti-GNRH1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNRH1 |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
GNAS Rabbit Polyclonal (aa385-394) Antibody
| Applications | IHC |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700473 |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
FSH beta (FSHB) mouse monoclonal antibody, clone 090-17275, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Active filters
Category
- Antibodies
Families
- Secreted Protein
Pathways
- GnRH signaling pathway