Germany
Japan
United Kingdom
China
Rat Anti-Human/Mouse OCT2 Purified (25 ug)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC22A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC22A2 Antibody: synthetic peptide directed towards the N terminal of human SLC22A2. Synthetic peptide located within the following region: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR |
Rabbit Polyclonal Anti-SLC22A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC22A2 |