Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA7A

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME

Rabbit polyclonal anti-SEMA7A antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SEMA7A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-202 amino acids from the N-terminal region of human SEMA7A.