Primary Antibodies

Jump to Filters
View as table Download
Mannan Binding Lectin (MBL2) Rabbit Polyclonal Antibody
TA332941

USD 275.00

3 Weeks

Rabbit anti-MBL2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBL2
Mannan Binding Lectin (MBL2) Rabbit Polyclonal Antibody
TA313357

USD 345.00

4 Weeks

Rabbit polyclonal anti-MBL2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MBL2.
Mannan Binding Lectin (MBL2) Rabbit Polyclonal Antibody
TA338382

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBL2 antibody: synthetic peptide directed towards the middle region of human MBL2. Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Mannan Binding Lectin (MBL2) Mouse Monoclonal Antibody [Clone ID: OTI1A12]
CF507147

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Mannan Binding Lectin (MBL2) Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF507149

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human
Conjugation Unconjugated