Primary Antibodies

View as table Download

Rabbit anti-MBL2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBL2

Rabbit polyclonal anti-MBL2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MBL2.

Rabbit Polyclonal Anti-MBL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBL2 antibody: synthetic peptide directed towards the middle region of human MBL2. Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Carrier-free (BSA/glycerol-free) MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".