ADI1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1 |
ADI1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1 |
Rabbit Polyclonal Anti-ADI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI |
Rabbit Polyclonal Anti-ADI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK |
Carrier-free (BSA/glycerol-free) ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".