Primary Antibodies

View as table Download

ADI1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1

Rabbit Polyclonal Anti-ADI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI

Rabbit Polyclonal Anti-ADI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK

Carrier-free (BSA/glycerol-free) ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".