Primary Antibodies

View as table Download

Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-21

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-21

IL-21 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

Rabbit Polyclonal IL-21 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

IL21 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-21

Rabbit polyclonal anti-IL21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IL21.

Mouse Polyclonal IL-21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full-length human IL-21

Rabbit Polyclonal Anti-IL21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS