Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-SGOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGOL1 Antibody: A synthesized peptide derived from human SGOL1 |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-SGOL1 (QORX) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human QORX. |
Rabbit polyclonal anti-SGOL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGOL1. |
Rabbit Polyclonal Shugoshin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 350-450). [Swiss-Prot# Q5FBB7] |
Rabbit Polyclonal Anti-SGOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGOL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGOL1. Synthetic peptide located within the following region: NSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDI |
