Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Rabbit Polyclonal Antibody against ISG15 (Center R87)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ISG15 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the Central region of human ISG15.

Anti-ISG15 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Carrier-free (BSA/glycerol-free) ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)

Applications WB
Reactivities Human
Conjugation Unconjugated