ISG15 Rabbit Polyclonal Antibody

CAT#: TA342596

Rabbit Polyclonal Anti-ISG15 Antibody

Product Images

WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human kidney

• 

  Sample Type: 1. Human NT-2 cells (60ug); 2. mouse brain extracts (80ug); Primary Antibody Dilution:2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution:1: 20,000; Image Submitted by: Yuzhi Chen; Uni

• 

  Host: Rabbit; Target Name: ISG15; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ISG15; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ISG15; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ISG15; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: ISG15; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml ISG15 is supported by BioGPS gene expression data to be expressed in MCF7

• Host: Rabbit; Target Name: ISG15; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml ISG15 is supported by BioGPS gene expression data to be expressed in HEK293T

• Application: IHC; Species+tissue/cell type: Mouse brain stem cells; Primary antibody dilution: 1:500; Secondary antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary antibody dilution: 1:1000

Show all 9 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: ISG15 ubiquitin-like modifier
• Database Link:
  NP_005092
  Entrez Gene 100038882 MouseEntrez Gene 9636 Human
  UniProt ID P05161
• Background: ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha.
• Synonyms: G1P2; hUCRP; IFI15; IMD38; IP17; UCRP
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: RIG-I-like receptor signaling pathway