Primary Antibodies

View as table Download

Rabbit polyclonal hnRNP C1/C2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2.

Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2

Rabbit Polyclonal Anti-HNRPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPC antibody: synthetic peptide directed towards the N terminal of human HNRPC. Synthetic peptide located within the following region: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ

Rabbit Polyclonal Anti-HNRNPC Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPC antibody: synthetic peptide directed towards the middle region of human HNRNPC. Synthetic peptide located within the following region: ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN

Rabbit Polyclonal Anti-hnRNP C1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRNP C1/2 Antibody: A synthesized peptide derived from human hnRNP C1/2

HNRNPC rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal hnRNP C1/2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human hnRNP C1/2

Rabbit Polyclonal hnRNP C1/2 (Ser260) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human hnRNP C1/2 around the phosphorylation site of Serine 260
Modifications Phospho-specific

HNRNPC rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

HNRNPC (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 282-310 amino acids from the C-terminal region of human hnRNP-C1/C2 / HNRNPC

Rabbit Polyclonal Anti-HNRNPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the C-terminal region of Human HNRNPC. Synthetic peptide located within the following region: ADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS

Rabbit Polyclonal Anti-HNRNPC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the middle region of Human HNRNPC. Synthetic peptide located within the following region: VDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGG

Rabbit Polyclonal Anti-CYP20A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPC