Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: HDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYL

Carrier-free (BSA/glycerol-free) FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-FARSB Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

FARSB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

FARSB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-589 of human FARSB (NP_005678.3).
Modifications Unmodified

FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated