Primary Antibodies

View as table Download

Rabbit anti-GCLM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GCLM

GCLM mouse monoclonal antibody, clone AT2D12, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

GCLM mouse monoclonal antibody, clone AT2D12, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Rabbit polyclonal GCLM Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

Rabbit Polyclonal GCLM Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-GCLM Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

GCLM Antibody

Applications WB
Conjugation Unconjugated

GCLM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

GCLM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human GCLM (NP_002052.1).
Modifications Unmodified