Primary Antibodies

View as table Download

GSTT1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTT1

Rabbit Polyclonal Anti-GSTT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Rabbit polyclonal anti-GSTT1/4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GSTT1/4.

GSTT1 mouse monoclonal antibody, clone AT38D11, Purified

Applications ELISA, WB
Reactivities Human

GSTT1 mouse monoclonal antibody, clone AT38D11, Purified

Applications ELISA, WB
Reactivities Human

Rabbit polyclonal antibody to GSTT1 (glutathione S-transferase theta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 240 of GSTT1 (Uniprot ID#P30711)

Rabbit polyclonal GSTT1 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-34 amino acids from the N-terminal region of human GSTT1.

Glutathione S Transferase theta 1 (GSTT1) (+GSTT4) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-GSTT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

GSTT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human GSTT1 (NP_000844.2).
Modifications Unmodified