Primary Antibodies

View as table Download

TYK2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-TYK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 Antibody: A synthesized peptide derived from human TYK2

Rabbit polyclonal antibody to TYK2 (tyrosine kinase 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 680 and 1187 of TYK2 (Uniprot ID#P29597)

Rabbit anti-TYK2 (Phospho-Tyr1054) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanTYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R).
Modifications Phospho-specific

Anti-TYK2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human tyrosine kinase 2

Rabbit Polyclonal TYK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal TYK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TYK2.

Rabbit Polyclonal anti-TYK2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP

Phospho-TYK2-Y1054 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1054 of human TYK2
Modifications Phospho-specific

TYK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TYK2

TYK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TYK2

TYK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TYK2

TYK2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human TYK2 (NP_003322.3).
Modifications Unmodified

Phospho-Tyk2-Y1054/1055 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y1054 & Y1055 of human Tyk2 (NP_003322.3).
Modifications Phospho Y1054/1055

Phospho-Tyk2-Y292 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y292 of human Tyk2 (NP_003322.3).
Modifications Phospho Y292