Primary Antibodies

Jump to Filters
View as table Download
UBN1 Rabbit Polyclonal Antibody
TA372063

USD 380.00

4 Weeks

UBN1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBN1
UBN1 (1-190) Mouse Monoclonal Antibody [Clone ID: UBN1-02]
AM26039PU-N

USD 270.00

2 Weeks

UBN1 (1-190) mouse monoclonal antibody, clone UBN1-02, Aff - Purified

Applications IP, WB
Reactivities Human
UBN1 Rabbit Polyclonal Antibody
TA315398

USD 345.00

4 Weeks

Rabbit polyclonal Ubinuclein antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Ubinuclein.
UBN1 Rabbit Polyclonal Antibody
TA342459

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM
UBN1 Goat Polyclonal Antibody
TA311462

USD 375.00

5 Days

Goat Anti-UBN/ Ubinuclein 1 & 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNSEAYDELVPASLT, from the internal region of the protein sequence according to NP_058632.2.
UBN1 Rabbit Polyclonal Antibody
TA367824

USD 380.00

4 Weeks

UBN1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBN1
UBN1 Rabbit Polyclonal Antibody
TA385520

USD 380.00

4 Weeks

Ubinuclein 1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ubinuclein. AA range:161-210