Primary Antibodies

View as table Download

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

Rabbit polyclonal anti-Perilipin A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 510 of mouse Perilipin A.

FABP4 (1-30) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH-conjugated synthetic peptide between amino acids 1-30 from human FABP4

Mouse monoclonal anti-FABP4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1

Rabbit Polyclonal Anti-CYP7A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP7A1

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)

Applications FC
Reactivities Human, Rat
Conjugation Unconjugated

CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)

Applications FC
Reactivities Human, Rat
Conjugation Unconjugated