TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Rat |
Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit Polyclonal Anti-ACSL3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Goat Polyclonal Antibody against CPT1A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1. |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit polyclonal anti-GLUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GLUT1. |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |