Primary Antibodies

View as table Download

Rabbit polyclonal Anti-Pigw Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pigw antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL

Rabbit polyclonal Anti-PIGW Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGW antibody: synthetic peptide directed towards the middle region of human PIGW. Synthetic peptide located within the following region: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV