Primary Antibodies

View as table Download

VCP Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 647-806 of human VCP (NP_009057.1).
Modifications Unmodified

Rabbit Polyclonal antibody to VCP (valosin-containing protein)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072)

Rabbit polyclonal VCP (Ser784) antibody(Phospho-specific)

Applications WB
Reactivities Human:Ser784, Mouse:Ser784, Rat:Ser784
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VCP around the phosphorylation site of serine 784.
Modifications Phospho-specific

Goat Anti-CDC48/ VCP / YDL126C (baker's yeast, aa128-142) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PIADTIEGITGNLFD, from the internal region of the protein sequence according to NP_010157.1

Rabbit Polyclonal Anti-VCP Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-VCP antibody: synthetic peptide directed towards the C terminal of human VCP. Synthetic peptide located within the following region: EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY

Goat Anti-CDC48 / VCP / YDL126C Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTKNMKLADDVDLE, from the internal region of the protein sequence according to NP_010157.1

Anti-VCP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 792-806 amino acids of human valosin containing protein

VCP Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human VCP

VCP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VCP

VCP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VCP

VCP Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human VCP

Rabbit polyclonal anti-VCP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCP

Rabbit polyclonal anti-VCP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCP