Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit polyclonal anti-EWSR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EWSR1. |
Rabbit polyclonal EWSR1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EWSR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 628-656 amino acids from the C-terminal region of human EWSR1. |
Rabbit polyclonal EWSR1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EWSR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 623-652 amino acids from the C-terminal region of human EWSR1. |
Goat Anti-EWS / EWSR1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSYDQSSYSQQNTYG, from the internal region of the protein sequence according to NP_053733.1; NP_005234.1. |
Anti-EWSR1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.213~217(T-Y-G-Q-P)derived from Human EWS. |
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: RGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY |
Rabbit anti EWSR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal segment of EWSR1 protein. This sequence is identical among human, rat, mouse and dog species. |
Goat Anti-EWS / EWSR1, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSYDQSSYSQQNTYG., from the internal region of the protein sequence according to NP_053733.2; NP_005234.1; NP_001156757.1; NP_001156758.1; NP_001156759.1. |
Germany
Japan
United Kingdom
China
