Primary Antibodies

Jump to Filters
View as table Download
TLR2 Rabbit Polyclonal Antibody
TA306125

USD 430.00

2 Weeks

Rabbit Polyclonal TLR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2.
TLR2 Rabbit Polyclonal Antibody
RA30053-50

USD 530.00

2 Weeks

TLR2 rabbit polyclonal antibody

Applications IHC, WB
Conjugation Unconjugated
TLR2 Rabbit Polyclonal Antibody
TA329156

USD 375.00

5 Days

Rabbit Polyclonal anti-TLR2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
TLR2 Rabbit Polyclonal Antibody
TA336461

USD 424.00

5 Days

Rabbit Polyclonal TLR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a mixture of synthetic peptides containing amino acids 180-196, 353-370, and 473-489 of human TLR2 (NP_003255).
TLR2 Rabbit Polyclonal Antibody
TA336413

USD 402.00

5 Days

Rabbit Polyclonal TLR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against an extracellular domain of mouse TLR2 (amino acids 564-580 and 751-770).
TLR2 Rabbit Polyclonal Antibody
TA322878

USD 345.00

In Stock

Anti-TLR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 143 amino acids of human toll-like receptor 2
TLR2 Rabbit Polyclonal Antibody
TA349550

USD 345.00

In Stock

Rabbit Polyclonal Anti-TLR2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TLR2