Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Rubicon Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rubicon antibody was raised against a 16 amino acid peptide near the amino terminus of human Rubicon.

Rabbit Polyclonal Anti-ERp72 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ERp72 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ERp72.

ERp72 (PDIA4) (623-638) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PDIA4 antibody was raised against a synthetic peptide based on the sequence of mouse ERp72 (residues 623-638) with a cysteine residue added and coupled to KLH.

Rabbit Polyclonal Anti-PDIA4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

Rabbit Polyclonal Anti-PDIA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the middle region of human PDIA4. Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA